PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G17000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 373aa    MW: 39712.3 Da    PI: 6.2703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G17000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  ORUFI04G17000.1 14 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding45.12.3e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  ORUFI04G17000.1  68 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.857965IPR017930Myb domain
SuperFamilySSF466899.73E-3011108IPR009057Homeodomain-like
SMARTSM007173.8E-141363IPR001005SANT/Myb domain
PfamPF002496.4E-171461IPR001005SANT/Myb domain
CDDcd001671.09E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.19766116IPR017930Myb domain
PfamPF002496.9E-1368110IPR001005SANT/Myb domain
CDDcd001672.02E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRVPCCEKD NVKRGQWTPE EDNKLLSYIT QYGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF TDAEEQTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKSFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRPS DFPSPAVHDG  180
AGAGASASAL AAPCFPAAPP HHPQADDTIE RIKLGLSRAI MSDPSTASAA AAAAAAPSAP  240
AEDKPWPPGD MSEGLAGMYA TYNPAAHAHA QAQAEFRYDG ASAAQGYVLG GDGDQGTSMW  300
SHQSLYSGSS GTEEARRALP EKGNDSVGSS GGDDDAADDG KDSGKGAASD MSGLFASDCV  360
LWDLPDELTN HMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8551660.0CR855166.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0124N08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635420.10.0PREDICTED: transcription factor MYB30
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0E0PAD20.0A0A0E0PAD2_ORYRU; Uncharacterized protein
STRINGBGIOSGA014912-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-112myb domain protein 103